General Information

  • ID:  hor000983
  • Uniprot ID:  P80345
  • Protein name:  Cholecystokinin-7
  • Gene name:  NA
  • Organism:  Trachemys scripta (Red-eared slider turtle) (Pseudemys scripta)
  • Family:  Gastrin/cholecystokinin family
  • Source:  animal
  • Expression:  Expressed in brain, duodenum and small intestine.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Trachemys (genus), Emydidae (family), Testudinoidea (superfamily), Durocryptodira, Cryptodira (suborder), Testudines (order), Testudinata (subclass), Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007586 digestion
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YMGWMDF
  • Length:  7(112-118)
  • Propeptide:  MYSGICIYMFLAMLSTSSSGQQATGSHNENPVATELEQSLTEHHRHVRVPSSAGQLKPIQRLDGNVDQKANIGALLAKYLQQARKGPTGRISMMGNRVQNIDPTHRINDRDYMGWMDFGRRSAEEYEYSS
  • Signal peptide:  MYSGICIYMFLAMLSTSSSG
  • Modification:  T1 Sulfotyrosine;T7 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut.
  • Mechanism:  Turtle brain contains CCK-octapeptide (CCK8) and CCK7, whereas the gut contains intact CCK33, CCK40 and CCK58.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P80345-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000983_AF2.pdbhor000983_ESM.pdb

Physical Information

Mass: 105631 Formula: C45H56N8O11S2
Absent amino acids: ACEHIKLNPQRSTV Common amino acids: M
pI: 3.75 Basic residues: 0
Polar residues: 2 Hydrophobic residues: 2
Hydrophobicity: 7.14 Boman Index: 209
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 0
Instability Index: 11202.86 Extinction Coefficient cystines: 6990
Absorbance 280nm: 1165

Literature

  • PubMed ID:  7925386
  • Title:  Identification of Cholecystokinin From Frog and Turtle. Divergence of Cholecystokinin and Gastrin Occurred Before the Evolution of Amphibia